• Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
  • Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
  • Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
  • Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
  • Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
  • Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Port: Shanghai, China
Production Capacity: 10kg/Month
Payment Terms: L/C, T/T, D/P, Western Union, Paypal, Money Gram
Powder: Yes
Customized: Customized
Certification: GMP, ISO 9001, USP, BP
Suitable for: Adult
State: Solid
Purity: 95%

You Might Also Like

Loading...

Basic Info.

Model NO.
Wucine-2219
Application
Anti Aging
Appearancr
White Powder
Certificate
ISO, GMP
Test Method
HPLC
Brand Name
Wucine
Sample
Available
Packaging
Foil Bag, Vial
Grade
Pharmaceutical Grade
Transport Package
1kg/Bag, 25kg/Drum
Specification
95%
Origin
Shaanxi, China
  • Our Advantages
  • Product Description
  • Detailed Photos
  • Company Profile
  • Our team
  • Packaging & Shipping
  • FAQ
Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Our Advantages

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Product Description

Anti aging Senolytics Foxo4 D-Retro-Inverso Peptide powder 95% FOXO4-DRI peptide 
 
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
Product Name
   FOXO4-DRI peptide 
CAS
   NA
Appearance
White powder
MOQ
  10mg
Purity
95%
Shelf Life
24 Months

Detailed Photos

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

 

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Function 
Within a certain concentration range, FOXO4-DRI can effectively kill senescent cells without affecting non-senescent cells and reverse senescence

Company Profile

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder
Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri PowderAvailable Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri PowderXi'an Wucine Bio Industries Inc is a national key high-tech enterprise,which mainly specializes
in the R&D,operation and production of pharmaceuticals,and intermediates.Our company is
situated in E&T development zone,xi'an city shaanxi,it is easy of access.Our company has
independent R&D center,raw material synthesis workshop,has advanced quality instruments
and equipmentm,several product patents there are 15 experts in our research team.We insist
in innovation and produce high quality products.

Our team

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri PowderAvailable Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

Packaging & Shipping

Available Stock Senolytics Foxo4 D-Retro-Inverso Peptide Foxo4-Dri Powder

FAQ

1. Are you a manufacturer or trade company?
We are a professional manufacturer.
2.What's your payment terms?
Standard terms: T/T in advance and Western Union.
Also L/C at sight is acceptable for large amount.
3.What's your shipping time?
We have a large stock, which means we can deliver the goods to you immediately.
4.How do you ensure the quality of your products?
Strict QC with 6 steps testing from raw material purchase to finished product.
5.How do you ship the order normally?
For large qty order,ship the goods by sea.
For small qty order, by air or express. We supply optional express for you, including DHL,FEDEX,UPS,TXT,EMS,and so on.
6.What's your loading port?
Usually Shanghai, Qingdao, Tianjin, Guangzhou


 

Send your message to this supplier

*From:
*To:
avatar Mr. Martin
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Xi'an Wucine Bio Industries Inc.

Xi'an Wucine Bio Industries Inc.

Since 2021

Diamond Member Since 2021

Suppliers with verified business licenses

5.0

Audited Suppliers

Contact Now

You Might Also Like

Loading...

Contact Supplier